PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01750g12001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 380aa    MW: 42552.6 Da    PI: 8.5481
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01750g12001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1614.7e-50321571127
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                               + pGfrF+Ptdeel+++yLkkk+eg++  + evi+ev+i k+ePwdLp k+v ++++ew+fFs+r +ky++g++++rat+sgyWk
  Niben101Scf01750g12001.1  32 MFPGFRFSPTDEELISYYLKKKLEGSDKCV-EVISEVEIWKHEPWDLPaKSVLQSDNEWFFFSPRGRKYPNGSQSKRATESGYWK 115
                               579************************777.99***************777788999**************************** PP

                       NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                               atgk+++v+s +++ +g+k+tLvf++grapkg++t+W+mhey 
  Niben101Scf01750g12001.1 116 ATGKERNVKS-GSNIIGTKRTLVFHTGRAPKGQRTHWIMHEYC 157
                               **********.99*****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-5628175IPR003441NAC domain
PROSITE profilePS5100554.11132176IPR003441NAC domain
PfamPF023652.0E-2634157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MEDGHVSGSR NEKGTTPRNN NVEISIATAS SMFPGFRFSP TDEELISYYL KKKLEGSDKC  60
VEVISEVEIW KHEPWDLPAK SVLQSDNEWF FFSPRGRKYP NGSQSKRATE SGYWKATGKE  120
RNVKSGSNII GTKRTLVFHT GRAPKGQRTH WIMHEYCTSG NTNYQDSMVV CRLRKNSEFH  180
LNDPPRNQRN QLAATLTATA QSGAGQLGSL ELVTAGDCCC SKEGSSSFYS HSVEQIDSGS  240
ESDKPTKEFS QHDSSGHIKD CDGEEDWFAD IMKDDIIKLD DSSLNAQPIS MVPSRPESSI  300
STHEARASMS SVAPFQGTAN RRLRFVREKV VVCPVEGSRI YEATKKNKIR VSTTSSGRWL  360
RNMFSVKTMK QYVMPIFLVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-442317511167NAC domain-containing protein 19
3swp_C1e-442317511167NAC domain-containing protein 19
3swp_B1e-442317511167NAC domain-containing protein 19
3swp_A1e-442317511167NAC domain-containing protein 19
3swm_D1e-442317511167NAC domain-containing protein 19
3swm_C1e-442317511167NAC domain-containing protein 19
3swm_B1e-442317511167NAC domain-containing protein 19
3swm_A1e-442317511167NAC domain-containing protein 19
4dul_B1e-44231758164NAC domain-containing protein 19
4dul_A1e-44231758164NAC domain-containing protein 19
1ut7_B1e-44231758164NO APICAL MERISTEM PROTEIN
1ut7_A1e-44231758164NO APICAL MERISTEM PROTEIN
1ut4_B1e-44231758164NO APICAL MERISTEM PROTEIN
1ut4_A1e-44231758164NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758643.10.0PREDICTED: NAC domain-containing protein 89-like
RefseqXP_016449980.10.0PREDICTED: NAC domain-containing protein 89-like
TrEMBLM1A5E50.0M1A5E5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000150770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.16e-78NTM1-like 8